Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Cobalt transport protein CbiN (cbiN)

This Recombinant Nostoc sp. Cobalt transport protein CbiN (cbiN) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiN, Energy-coupling factor transporter probable substrate-capture protein CbiN, ECF transporter S component CbiN

UniProt

Q8YQ90

Expression Region

1-100

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQSKQSLSNWLLIGGVIALAVLPLIFVRDAEFTGADSQAEKAISEVKPGYEPWFKPLFE PPSGEVESLLFSSQAALGAGIIGYAVGLYKGRSQQQRHKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Limonin
TRC-L461780-5MG 5 mg

Limonin

Sign In for Pricing
View Details
PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF740 conjugate, 0.1mg/mL
BNC742746-100 1x 100 µL

PD-L1 / PDCD1LG1 / CD274 / B7-H1 (Cancer Immunotherapy Target) (PDL1/2746), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Amino-3-isopropyl-1H-1,2,4-triazol-5(4H)-one
TRC-A723355-250MG 250 mg

4-Amino-3-isopropyl-1H-1,2,4-triazol-5(4H)-one

Sign In for Pricing
View Details
ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]
TA502920AM 100 µL

ADH1B Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3F2]

Sign In for Pricing
View Details
Ibrutinib-d4 (Major)
TRC-I124971-2.5MG 2.5 mg

Ibrutinib-d4 (Major)

Sign In for Pricing
View Details
QuantiFluo™ α-Amylase Inhibitor Screening Kit
IAMY-400 400 Tests

QuantiFluo™ α-Amylase Inhibitor Screening Kit

Sign In for Pricing
View Details