Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T2

Expression Region

1-100

Origin

Influenza A virus (strain A/Chicken/Hong Kong/FY150/2001 H5N1 genotype D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETYVLPTRNEWECRCSGSSDPLVVASSIIGILHLILWILDRLFFKCIYRRLKY GLKRGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF568 conjugate, 0.1mg/mL
BNC682592-500 1x 500 µL

Aldo-keto Reductase Family 1 Member B1 (Adrenal Marker) (CPTC-AKR1B1-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Carboxy Detomidine
TRC-C177915-5MG 5 mg

3-Carboxy Detomidine

Sign In for Pricing
View Details
ESD (NM_001984) Human Recombinant Protein
TP720113M 50 µg

ESD (NM_001984) Human Recombinant Protein

Sign In for Pricing
View Details
4-Chloro-1H-imidazole
TRC-C366825-500MG 500 mg

4-Chloro-1H-imidazole

Sign In for Pricing
View Details
1-hydroxypentan-2-one
TRC-H100560-50MG 50 mg

1-hydroxypentan-2-one

Sign In for Pricing
View Details
MAGE A1 (MZ2E/838), CF647 conjugate, 0.1mg/mL
BNC470838-500 1x 500 µL

MAGE A1 (MZ2E/838), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details