Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Matrix protein 2 (M)

This Recombinant Influenza A virus Matrix protein 2 (M) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Matrix protein 2, Proton channel protein M2

UniProt

P0C5T2

Expression Region

1-100

Origin

Influenza A virus (strain A/Chicken/Hong Kong/FY150/2001 H5N1 genotype D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLTEVETYVLPTRNEWECRCSGSSDPLVVASSIIGILHLILWILDRLFFKCIYRRLKY GLKRGPSTEGVPESMREEYRQEQQSAVDVDDGHFVNIELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAA1 (NM_001607) Human Over-expression Lysate
LC400605 20 µg

ACAA1 (NM_001607) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-01 20 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-02 100 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]
E-AB-F1172M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human IgM Antibody[MHM-88]

Sign In for Pricing
View Details
WWOX Recombinant Rabbit monoclonal Antibody
HA751558 100 µL

WWOX Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
2,4-Dichloro-quinoline-3-carboxylic Acid Ethyl Ester
TRC-D742600-500MG 500 mg

2,4-Dichloro-quinoline-3-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details