Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P30345

Expression Region

1-100

Origin

Streptomyces lividans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPPPTQPGDRRGGLLGTLAVVGVALLPIICCAGPVLLASGALAGLGGVLVSPWLLAPAA VLLAGALTWWLRRRRTGNGDACCLPAPRTDQHDRDLLRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOA Human Gene Knockout Kit (CRISPR)
KN203303LP 1 Kit

RHOA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
7-Aminoheptanoic Acid Ethyl Ester Hydrochloride
TRC-A609925-1G 1 g

7-Aminoheptanoic Acid Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), Biotin conjugate, 0.1mg/mL
BNCB2200-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RC3H1 (NM_172071) Human Recombinant Protein
TP312335L 1 mg

RC3H1 (NM_172071) Human Recombinant Protein

Sign In for Pricing
View Details
Noggin (NOG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H8]
TA500029AM 100 µL

Noggin (NOG) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H8]

Sign In for Pricing
View Details
Sarcosine-13C3
TRC-S140503-1MG 1 mg

Sarcosine-13C3

Sign In for Pricing
View Details