Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mercuric transport protein (merT)

This Recombinant Mercuric transport protein (merT) spans the amino acid sequence from region 1-100.

Product Specifications

Product Name Alternative

Mercuric transport protein, Mercury ion transport protein

UniProt

P30345

Expression Region

1-100

Origin

Streptomyces lividans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTPPPTQPGDRRGGLLGTLAVVGVALLPIICCAGPVLLASGALAGLGGVLVSPWLLAPAA VLLAGALTWWLRRRRTGNGDACCLPAPRTDQHDRDLLRKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Serpin B5/Maspin Antibody (SERPINB5/4978)
NBP3-20295-100ug 100 µg

Mouse Monoclonal Serpin B5/Maspin Antibody (SERPINB5/4978)

Sign In for Pricing
View Details
VCY1 Rabbit Polyclonal Antibody
BT-AP13432-01 20 µL

VCY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VCY1 Rabbit Polyclonal Antibody
BT-AP13432-02 50 µL

VCY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VCY1 Rabbit Polyclonal Antibody
BT-AP13432-03 100 µL

VCY1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VDAC1 Protein Vector (Human) (pPM-C-HA)
PV045723 500 ng

VDAC1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
SLC11A1 siRNA (Human)
CRH4446-01 15 nmol

SLC11A1 siRNA (Human)

Sign In for Pricing
View Details