Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yqjD (yqjD)

This Recombinant Uncharacterized protein yqjD (yqjD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein yqjD

UniProt

P64584

Expression Region

1-101

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSC22D3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]
TA505355BM 100 µL

TSC22D3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1H3]

Sign In for Pricing
View Details
Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI2E2]
CF810158 100 µg

Calcium binding protein P22 (CHP1) Mouse Monoclonal Antibody [Clone ID: OTI2E2]

Sign In for Pricing
View Details
Human S100P / S100E Protein, Tag Free
S1P-H5110-1mg 1 mg

Human S100P / S100E Protein, Tag Free

Sign In for Pricing
View Details
PARG Mouse Monoclonal Antibody [Clone ID: OTI9F6]
CF808712 100 µg

PARG Mouse Monoclonal Antibody [Clone ID: OTI9F6]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD23 Antibody[B3B4]
E-AB-F1178M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD23 Antibody[B3B4]

Sign In for Pricing
View Details