Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yqjD (yqjD)

This Recombinant Uncharacterized protein yqjD (yqjD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein yqjD

UniProt

P64583

Expression Region

1-101

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SF3B4 Protein, N-His
orb3150546-01 50 µg

Recombinant Human SF3B4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SF3B4 Protein, N-His
orb3150546-02 100 µg

Recombinant Human SF3B4 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human SF3B4 Protein, N-His
orb3150546-03 1 mg

Recombinant Human SF3B4 Protein, N-His

Sign In for Pricing
View Details
Ftsj1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4891607 1.0 µg DNA

Ftsj1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to B And T-Lymphocyte Attenuator (BTLA)
MBS2058276-01 0.1 mL

Cy3-Linked Polyclonal Antibody to B And T-Lymphocyte Attenuator (BTLA)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to B And T-Lymphocyte Attenuator (BTLA)
MBS2058276-02 0.2 mL

Cy3-Linked Polyclonal Antibody to B And T-Lymphocyte Attenuator (BTLA)

Sign In for Pricing
View Details