Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yqjD (yqjD)

This Recombinant Uncharacterized protein yqjD (yqjD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein yqjD

UniProt

P64582

Expression Region

1-101

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENT1, CT (Equilibrative Nitrobenzylmercaptopurine Riboside-sensitive Nucleoside Transporter, Equilibrative NBMPR-sensitive Nucleoside Transporter, Nucleoside Transporter, es-type, Solute Carrier Family 29 Member 1, Slc29a1, Equilibrative Nucleoside Transporter 1) (MaxLight 550) discontinued
E3225-01-ML550 100 µL

ENT1, CT (Equilibrative Nitrobenzylmercaptopurine Riboside-sensitive Nucleoside Transporter, Equilibrative NBMPR-sensitive Nucleoside Transporter, Nucleoside Transporter, es-type, Solute Carrier Family 29 Member 1, Slc29a1, Equilibrative Nucleoside Transporter 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
KIAA1967 Rabbit Monoclonal Antibody
E56G3277 100 µL

KIAA1967 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal USH1C Antibody
NBP2-99408-100ul 100 µL

Rabbit Polyclonal USH1C Antibody

Sign In for Pricing
View Details
ZNF146 Antibody
A44724-100UL 100 µL

ZNF146 Antibody

Sign In for Pricing
View Details
Recombinant Pongo abelii C-Myc-binding protein (MYCBP)
MBS1374978-01 0.02 mg (E-Coli)

Recombinant Pongo abelii C-Myc-binding protein (MYCBP)

Sign In for Pricing
View Details
Recombinant Pongo abelii C-Myc-binding protein (MYCBP)
MBS1374978-02 0.1 mg (E-Coli)

Recombinant Pongo abelii C-Myc-binding protein (MYCBP)

Sign In for Pricing
View Details