Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yqjD (yqjD)

This Recombinant Uncharacterized protein yqjD (yqjD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein yqjD

UniProt

P64582

Expression Region

1-101

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKEHTTEHLRAELKSLSDTLEEVLSSSGEKSKEELSKIRSKAEQALKQSRYRLGETGDA IAKQTRVAAARADEYVRENPWTGVGIGAAIGVVLGVLLSRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP1 (hRap1, Telomeric Repeat Binding Factor 2 Interacting Protein, TERF2IP, TRF2 Interacting Telomeric Protein RAP1) discontinued
376733 500 µg

RAP1 (hRap1, Telomeric Repeat Binding Factor 2 Interacting Protein, TERF2IP, TRF2 Interacting Telomeric Protein RAP1) discontinued

Sign In for Pricing
View Details
Neuregulin 2 (NRG2) Polyclonal Antibody
CAU24589-01 100 µL

Neuregulin 2 (NRG2) Polyclonal Antibody

Sign In for Pricing
View Details
Neuregulin 2 (NRG2) Polyclonal Antibody
CAU24589-02 200 µL

Neuregulin 2 (NRG2) Polyclonal Antibody

Sign In for Pricing
View Details
Ola1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3045408 1.0 µg DNA

Ola1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Putative deoxyribonuclease TATDN1 (TATDN1) Mouse ELISA Kit
G5266 96 Tests

Putative deoxyribonuclease TATDN1 (TATDN1) Mouse ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CD11b/c Antibody [Dylight 680]
NB110-40766FR 0.1 mL

Rabbit Polyclonal CD11b/c Antibody [Dylight 680]

Sign In for Pricing
View Details