Recombinant Agrostis stolonifera NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic
This Recombinant Agrostis stolonifera NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic spans the amino acid sequence from region 1-101.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 4L, NADH-plastoquinone oxidoreductase subunit 4L
UniProt
A1EA61
Expression Region
1-101
Origin
Agrostis stolonifera (Creeping bentgrass)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MMFEHVLFLSVYLFSIGIYGLITSRNMVRALICLELILNSINLNLVTFSDLFDSRQLKGD IFAIFVIALAAAEAAIGLSILSSIHRNRKSTRINQSNLLNN
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470043-500 1x 500 µL
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880629-100 1x 100 µL
CD59 (heavy chain of Protectin) (MACIF/629), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details