Recombinant Populus trichocarpa NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic
This Recombinant Populus trichocarpa NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic spans the amino acid sequence from region 1-101.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 4L, NADH-plastoquinone oxidoreductase subunit 4L
UniProt
A4GYW8
Expression Region
1-101
Origin
Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MMLEYVLGLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGN IFSIFVISIAAAEAAIGPAIVSSIYRNRKSIRINQLNLLNK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470226-500 1x 500 µL
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details