Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lepidium virginicum NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic

This Recombinant Lepidium virginicum NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

NAD (P) H-quinone oxidoreductase subunit 4L, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 4L, NADH-plastoquinone oxidoreductase subunit 4L

UniProt

A4QLG1

Expression Region

1-101

Origin

Lepidium virginicum (Virginia pepperweed)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILEHVLVLSAYLFLIGLYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDNSQLKGD IFCIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSTLLNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-500 1x 500 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-500 1x 500 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-100 1x 100 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (ASTRO/789), CF488A conjugate, 0.1mg/mL
BNC880789-100 1x 100 µL

GFAP (ASTRO/789), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), CF640R conjugate, 0.1mg/mL
Cyclin B1 (V92.1), CF568 conjugate, 0.1mg/mL
BNC680680-100 1x 100 µL

Cyclin B1 (V92.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details