Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE)

This Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein ynzE

UniProt

O34356

Expression Region

1-101

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTDPAEEAFLPNFLLLGAGTALVLCLVFFLYQKLDQSQFAVIKLGIWGSAVGLLMDTIS LWNLPLIFPALSKGQVIAFTIWMVCAYCMYLLIPLILSHKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Zfhx3 shRNA (UAS) - Lentiviral mouse Zfhx3 shRNA (UAS, RFP) (25)
GTR15132203 1 Vial

Lentiviral mouse Zfhx3 shRNA (UAS) - Lentiviral mouse Zfhx3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Digital Meters
1091760/9 1 Each

Digital Meters

Sign In for Pricing
View Details
KCNN4 Antibody
DF6727-01 100 µL

KCNN4 Antibody

Sign In for Pricing
View Details
KCNN4 Antibody
DF6727-02 200 µL

KCNN4 Antibody

Sign In for Pricing
View Details
Octanoic acid
O01160 500 mL

Octanoic acid

Sign In for Pricing
View Details
ASCL2, NT (ASCL2, BHLHA45, HASH2, Achaete-scute homolog 2, Class A basic helix-loop-helix protein 45, Mash2) (AP) discontinued
032132-AP 200 µL

ASCL2, NT (ASCL2, BHLHA45, HASH2, Achaete-scute homolog 2, Class A basic helix-loop-helix protein 45, Mash2) (AP) discontinued

Sign In for Pricing
View Details