Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE)

This Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein ynzE

UniProt

O34356

Expression Region

1-101

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTDPAEEAFLPNFLLLGAGTALVLCLVFFLYQKLDQSQFAVIKLGIWGSAVGLLMDTIS LWNLPLIFPALSKGQVIAFTIWMVCAYCMYLLIPLILSHKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hakai (HRP) discontinued
H1740-HRP 100 µL

Hakai (HRP) discontinued

Sign In for Pricing
View Details
CLUH Knockout AGS Polyclonal Cells
ARG2717 1 Million

CLUH Knockout AGS Polyclonal Cells

Sign In for Pricing
View Details
Mouse Ckap5 Pre-designed siRNA Set A
SI102648A 1 Each

Mouse Ckap5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1 (C-6His)
32-7382-50 50 µg

Recombinant Human Asialoglycoprotein Receptor 1/ASGPR1 (C-6His)

Sign In for Pricing
View Details
Brenetafusp (Reference antibody)
E55B1334 100 µg

Brenetafusp (Reference antibody)

Sign In for Pricing
View Details
Recombinant Escherichia coli L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)
MBS1113120-01 0.02 mg (E-Coli)

Recombinant Escherichia coli L-ribulose-5-phosphate 3-epimerase UlaE (ulaE)

Sign In for Pricing
View Details