Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE)

This Recombinant Bacillus subtilis Uncharacterized protein ynzE (ynzE) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein ynzE

UniProt

O34356

Expression Region

1-101

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTDPAEEAFLPNFLLLGAGTALVLCLVFFLYQKLDQSQFAVIKLGIWGSAVGLLMDTIS LWNLPLIFPALSKGQVIAFTIWMVCAYCMYLLIPLILSHKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-01 0.01 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-02 0.1 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-03 5x 0.01 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-cAbl Antibody, Affinity Purified
MBS3902128-04 5x 0.1 mg

Rabbit anti-cAbl Antibody, Affinity Purified

Sign In for Pricing
View Details
Ammonium Ceric Nitrate 0.05 N Volumetric Solution (N/20)
00195 00500 500 mL

Ammonium Ceric Nitrate 0.05 N Volumetric Solution (N/20)

Sign In for Pricing
View Details
Phospho-HDAC4 (Ser632) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2553095 100 µL

Phospho-HDAC4 (Ser632) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details