Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype C Movement protein (V2)

This Recombinant Maize streak virus genotype C Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

O40984

Expression Region

1-101

Origin

Maize streak virus genotype C (isolate Set) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLEPTAPVHPGPFVPGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin 1B Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62032R-PerCP-Cy5.5 100 µL

Syntaxin 1B Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Regulator Of G Protein Signaling 9 (RGS9) Magnetic Fluorescence Assay Kit
MBS2159478-01 96 Tests

Regulator Of G Protein Signaling 9 (RGS9) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Regulator Of G Protein Signaling 9 (RGS9) Magnetic Fluorescence Assay Kit
MBS2159478-02 5x 96 Tests

Regulator Of G Protein Signaling 9 (RGS9) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Regulator Of G Protein Signaling 9 (RGS9) Magnetic Fluorescence Assay Kit
MBS2159478-03 10x 96 Tests

Regulator Of G Protein Signaling 9 (RGS9) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Mouse Anti-Human LMO2 monoclonal antibody, clone JID726
CABT-L2874-01 100 µl, 500 µl

Mouse Anti-Human LMO2 monoclonal antibody, clone JID726

Sign In for Pricing
View Details
Mouse Anti-Human LMO2 monoclonal antibody, clone JID726
CABT-L2874-02 100 uL, 500 uL

Mouse Anti-Human LMO2 monoclonal antibody, clone JID726

Sign In for Pricing
View Details