Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype C Movement protein (V2)

This Recombinant Maize streak virus genotype C Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

O40984

Expression Region

1-101

Origin

Maize streak virus genotype C (isolate Set) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLEPTAPVHPGPFVPGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thrombospondin Type-1 Domain-Containing Protein 7A (THSD7A) Protein
abx620635-01 100 µg

Human Thrombospondin Type-1 Domain-Containing Protein 7A (THSD7A) Protein

Sign In for Pricing
View Details
Human Thrombospondin Type-1 Domain-Containing Protein 7A (THSD7A) Protein
abx620635-02 1 mg

Human Thrombospondin Type-1 Domain-Containing Protein 7A (THSD7A) Protein

Sign In for Pricing
View Details
Rabbit Polyclonal CEP290 Antibody [DyLight 650]
NB100-86991C 100 µL

Rabbit Polyclonal CEP290 Antibody [DyLight 650]

Sign In for Pricing
View Details
EP3 HDR Plasmid (h2)
sc-402485-HDR-2 20 µg

EP3 HDR Plasmid (h2)

Sign In for Pricing
View Details
8-Hydroxy-5,6,7,8-tetrahydroquinoline hydrochloride
OR470051 1 Each

8-Hydroxy-5,6,7,8-tetrahydroquinoline hydrochloride

Sign In for Pricing
View Details
Respiratory Syncytial Virus (RSV) Antigen
orb1733549 250 µg

Respiratory Syncytial Virus (RSV) Antigen

Sign In for Pricing
View Details