Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype C Movement protein (V2)

This Recombinant Maize streak virus genotype C Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

O40984

Expression Region

1-101

Origin

Maize streak virus genotype C (isolate Set) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLEPTAPVHPGPFVPGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGAP1-IT1 Protein Lysate (Human) with C-Ha Tag
11493031 100 µg

AGAP1-IT1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
TBC1D13, ID (TBC1D13, TBC1 domain family member 13) (FITC)
MBS6353856-01 0.2 mL

TBC1D13, ID (TBC1D13, TBC1 domain family member 13) (FITC)

Sign In for Pricing
View Details
TBC1D13, ID (TBC1D13, TBC1 domain family member 13) (FITC)
MBS6353856-02 5x 0.2 mL

TBC1D13, ID (TBC1D13, TBC1 domain family member 13) (FITC)

Sign In for Pricing
View Details
LILRB2/CD85d/ILT4 mFc Chimera, Human
Z05596-100 100 µg

LILRB2/CD85d/ILT4 mFc Chimera, Human

Sign In for Pricing
View Details
H2-Q6 Protein Vector (Mouse) (pPB-N-His)
PV187687 500 ng

H2-Q6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-P4HA3 antibody
STJ115714 100 µl

Anti-P4HA3 antibody

Sign In for Pricing
View Details