Recombinant Schizosaccharomyces pombe Uncharacterized protein C2F3.07c (SPAC2F3.07c)
This Recombinant Schizosaccharomyces pombe Uncharacterized protein C2F3.07c (SPAC2F3.07c) spans the amino acid sequence from region 1-101.
Product Specifications
Product Name Alternative
Uncharacterized protein C2F3.07c
UniProt
O14090
Expression Region
1-101
Origin
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLVRENNSNDRSIIEYVIKILLISGISRIIILILAMFESIRHIIFHNDTNPSDARKFQMA ICRLSSQKSRKLKNPIESSTTSHKKKGYVRKCYECLQIQVS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470738-100 1x 100 µL
TAG-72 / CA72.4 (B72.3 + CC49), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-B227110-25MG 25 mg
1-(1,3-benzodioxol-5-yl)-2-(1-pyrrolidinyl)-1-Hexanone hydrochloride
Sign In for Pricing
View Details 