Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C2F3.07c (SPAC2F3.07c)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C2F3.07c (SPAC2F3.07c) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein C2F3.07c

UniProt

O14090

Expression Region

1-101

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVRENNSNDRSIIEYVIKILLISGISRIIILILAMFESIRHIIFHNDTNPSDARKFQMA ICRLSSQKSRKLKNPIESSTTSHKKKGYVRKCYECLQIQVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF1-AS1 (NM_001013717) Human Over-expression Lysate
LY423025 100 µg

IRF1-AS1 (NM_001013717) Human Over-expression Lysate

Sign In for Pricing
View Details
Bcl-2 Recombinant Rabbit monoclonal Antibody
HA750350 100 µL

Bcl-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
L-Tyrosine-13C9,15N
TRC-T899976-5MG 5 mg

L-Tyrosine-13C9,15N

Sign In for Pricing
View Details
TMEM190 Human Gene Knockout Kit (CRISPR)
KN417222 1 Kit

TMEM190 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rffl Mouse Gene Knockout Kit (CRISPR)
KN514694 1 Kit

Rffl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARC Polyclonal Antibody
E-AB-10826-01 20 µL

ARC Polyclonal Antibody

Sign In for Pricing
View Details