Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein C18orf62 (C18orf62)

This Recombinant Human Putative uncharacterized protein C18orf62 (C18orf62) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Putative uncharacterized protein C18orf62

UniProt

Q3B7S5

Expression Region

1-101

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDQYVSTAPPRFPIAQLGTFKQDSAGMGRIFKGNLLQKKALTTFENEHHIRFFTLLVLFH VMVLLRNHSRIQGVSEDWKRANSIFRNFLRLKSSRNTAEAE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPEF1 (NM_006240) Human Over-expression Lysate
LC401877 20 µg

PPEF1 (NM_006240) Human Over-expression Lysate

Sign In for Pricing
View Details
CMTM2 Polyclonal Antibody
E-AB-14002-01 20 µL

CMTM2 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM2 Polyclonal Antibody
E-AB-14002-02 60 µL

CMTM2 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM2 Polyclonal Antibody
E-AB-14002-03 120 µL

CMTM2 Polyclonal Antibody

Sign In for Pricing
View Details
CMTM2 Polyclonal Antibody
E-AB-14002-04 200 µL

CMTM2 Polyclonal Antibody

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-100 1x 100 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details