Recombinant Mycoplasma hyopneumoniae ATP synthase subunit c (atpE)
This Recombinant Mycoplasma hyopneumoniae ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-101.
Product Specifications
Product Name Alternative
ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein
UniProt
Q4A8W4
Expression Region
1-101
Origin
Mycoplasma hyopneumoniae (strain 7448)
Field of Research
Infectious Disease & Virology; Metabolism Research
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNSIVNFSQQLIQNFQEVSQKTVADSSNLKAFAYLGAGLAMIGVIGVGAGQGYAAGKACD AIARNPEAQKQVFRVLVIGTAISETSSIYALLVALILIFVG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details