Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD, PGA synthesis protein IcaD, Poly-beta-1,6-GlcNAc synthesis protein IcaD, Biofilm polysaccharide intercellular ad

UniProt

Q5HCN0

Expression Region

1-101

Origin

Staphylococcus aureus (strain COL)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitro-5- (thiomorpholin-4-yl) aniline
OR310468-01 1 g

2-Nitro-5- (thiomorpholin-4-yl) aniline

Sign In for Pricing
View Details
2-Nitro-5- (thiomorpholin-4-yl) aniline
OR310468-02 5 g

2-Nitro-5- (thiomorpholin-4-yl) aniline

Sign In for Pricing
View Details
GABRA6 (aa15-26) Antibody
orb131691 100 µg

GABRA6 (aa15-26) Antibody

Sign In for Pricing
View Details
Human chemokine (C-X-C motif) ligand 9 (CXCL9) ELISA kit
MBS284308-01 48 Tests

Human chemokine (C-X-C motif) ligand 9 (CXCL9) ELISA kit

Sign In for Pricing
View Details
Human chemokine (C-X-C motif) ligand 9 (CXCL9) ELISA kit
MBS284308-02 96 Tests

Human chemokine (C-X-C motif) ligand 9 (CXCL9) ELISA kit

Sign In for Pricing
View Details
Human chemokine (C-X-C motif) ligand 9 (CXCL9) ELISA kit
MBS284308-03 5x 96 Tests

Human chemokine (C-X-C motif) ligand 9 (CXCL9) ELISA kit

Sign In for Pricing
View Details