Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b)

This Recombinant Xenopus laevis Ribonuclease kappa-B (rnasek-b) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Ribonuclease kappa-B, RNase K-B, RNase kappa-B, EC= 3.1.-.-

UniProt

Q566G2

Expression Region

1-101

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVSLLCCGPKLAACGIVLSVWGVIMLVLLGVFFNVHSAVLIEDVPFTEADMFEDPNPPAK MYRLYEQVSYNCFIAAAIYIVLGGFSFCQVRLNKRKEYMVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF568 conjugate, 0.1mg/mL
BNC680499-100 1x 100 µL

Cytokeratin 14 (LL002), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (BAX/962), CF405S conjugate, 0.1mg/mL
BNC040962-100 1x 100 µL

Bax (BAX/962), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66, pan (CEA) (Cocktail), CF594 conjugate, 0.1mg/mL
BNC941139-100 1x 100 µL

CD66, pan (CEA) (Cocktail), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details