Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein R40

UniProt

Q5UPC1

Expression Region

1-101

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNNFRDSVLAILVCQFIGPNVFIIIGSIGSVIGVKIMEMYPHYCENHGIYIDKTSVGI AHGIYGIILGFIGIYVFLFVLLFILSIIFSIIYVISKRLSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat MAPT Matched Antibody Pair Set [ABP-S-052110]
ABP-S-052110 5 Plates

Rat MAPT Matched Antibody Pair Set [ABP-S-052110]

Sign In for Pricing
View Details
PLV3-U6-STC1-shRNA3-Puro Plasmid
PVT75059 2 µg

PLV3-U6-STC1-shRNA3-Puro Plasmid

Sign In for Pricing
View Details
AMPK alpha-1 Mouse Monoclonal Antibody (PE-Cy7)
orb969721 100 µL

AMPK alpha-1 Mouse Monoclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
March11 AAV Vector (Mouse) (CMV)
28096104 1 µg

March11 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Human CCL8/MCP-2 Biotinylated Affinity Purified PAb
BAF281 50 µg

Human CCL8/MCP-2 Biotinylated Affinity Purified PAb

Sign In for Pricing
View Details
Human HSP13 ELISA Kit
E103326 1 Each

Human HSP13 ELISA Kit

Sign In for Pricing
View Details