Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein R40 (MIMI_R40) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Uncharacterized protein R40

UniProt

Q5UPC1

Expression Region

1-101

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENNNFRDSVLAILVCQFIGPNVFIIIGSIGSVIGVKIMEMYPHYCENHGIYIDKTSVGI AHGIYGIILGFIGIYVFLFVLLFILSIIFSIIYVISKRLSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Solanum tuberosum Maturase K (matK), partial
MBS1087615 Inquire

Recombinant Solanum tuberosum Maturase K (matK), partial

Sign In for Pricing
View Details
Benzyl-2-acetamido-2-deoxy-3,6-di-O-benzyl-alpha-D-glucopyranoside
sc-358057A 1 g

Benzyl-2-acetamido-2-deoxy-3,6-di-O-benzyl-alpha-D-glucopyranoside

Sign In for Pricing
View Details
Recombinant Human CSF3R protein, N-His Tag
IMP-3218 10 µg

Recombinant Human CSF3R protein, N-His Tag

Sign In for Pricing
View Details
LINC00900 Human shRNA Lentiviral Particle (Locus ID 283143)
TL320190V 500 µL Each

LINC00900 Human shRNA Lentiviral Particle (Locus ID 283143)

Sign In for Pricing
View Details
LTK Polyclonal Antibody, FITC Conjugated
bs-15500R-FITC 100 µL

LTK Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
SLCO1B7 Rabbit Polyclonal Antibody (Fluoro488)
orb3092148 100 µg

SLCO1B7 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details