Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter sp. UPF0060 membrane protein ACIAD1364 (ACIAD1364)

This Recombinant Acinetobacter sp. UPF0060 membrane protein ACIAD1364 (ACIAD1364) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ACIAD1364

UniProt

Q6FCI0

Expression Region

1-101

Origin

Acinetobacter sp. (strain ADP1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTALAEILGCYFPYLILKEGKTHWLWLPAIISLAVFVWLLTLHPAASGRIYAAYGGIYIF TALMWLRFIDQVTLTRWDIWGGTVVLLGAALIILQPQGLLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Tagged ORF Clone Lentiviral Particle
RC228166L2V 200 µL

Class A basic helix loop helix protein 9 (BHLHA9) (NM_001164405) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FineTest®647 Anti-Human CD19 (CB19)
F647-30066-01 20 Tests

FineTest®647 Anti-Human CD19 (CB19)

Sign In for Pricing
View Details
FineTest®647 Anti-Human CD19 (CB19)
F647-30066-02 100 Tests

FineTest®647 Anti-Human CD19 (CB19)

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin A (SEA) (APC)
MBS6127122-01 0.1 mL

Staphylococcus aureus Enterotoxin A (SEA) (APC)

Sign In for Pricing
View Details
Staphylococcus aureus Enterotoxin A (SEA) (APC)
MBS6127122-02 5x 0.1 mL

Staphylococcus aureus Enterotoxin A (SEA) (APC)

Sign In for Pricing
View Details
LgA Antibody (Center) (Ascites) [AMM02442G]
AMM02442G-01 50 µL

LgA Antibody (Center) (Ascites) [AMM02442G]

Sign In for Pricing
View Details