Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD, PGA synthesis protein IcaD, Poly-beta-1,6-GlcNAc synthesis protein IcaD, Biofilm polysaccharide intercellular ad

UniProt

Q7A2K4

Expression Region

1-101

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TDP-43/TARDBP Antibody (3H8) [DyLight 350]
NBP1-92695UV 0.1 mL

Mouse Monoclonal TDP-43/TARDBP Antibody (3H8) [DyLight 350]

Sign In for Pricing
View Details
MIR7676-2 Mouse qPCR Template Standard (MI0025018)
MK301154 200 Reactions

MIR7676-2 Mouse qPCR Template Standard (MI0025018)

Sign In for Pricing
View Details
Cytochrome P450 3A5 (CYP3A5) Antibody
abx149668-01 50 µg

Cytochrome P450 3A5 (CYP3A5) Antibody

Sign In for Pricing
View Details
Cytochrome P450 3A5 (CYP3A5) Antibody
abx149668-02 100 µg

Cytochrome P450 3A5 (CYP3A5) Antibody

Sign In for Pricing
View Details
Dolutegravir intermediate-1
T11074-01 1 mL - 10 mM (in DMSO)

Dolutegravir intermediate-1

Sign In for Pricing
View Details
Dolutegravir intermediate-1
T11074-02 5 g

Dolutegravir intermediate-1

Sign In for Pricing
View Details