Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD, PGA synthesis protein IcaD, Poly-beta-1,6-GlcNAc synthesis protein IcaD, Biofilm polysaccharide intercellular ad

UniProt

Q7A350

Expression Region

1-101

Origin

Staphylococcus aureus (strain N315)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX10 Rabbit Polyclonal Antibody (Biotin)
orb2081794 100 µL

DDX10 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RSV Monoclonal Antibody
VAnt-Wyb495 Each

RSV Monoclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)
MBS2142604-01 0.1 mL

FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)
MBS2142604-02 0.2 mL

FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)
MBS2142604-03 0.5 mL

FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)
MBS2142604-04 1 mL

FITC-Linked Monoclonal Antibody to Actin Alpha 2, Smooth Muscle (ACTa2)

Sign In for Pricing
View Details