Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD, PGA synthesis protein IcaD, Poly-beta-1,6-GlcNAc synthesis protein IcaD, Biofilm polysaccharide intercellular ad

UniProt

Q6GDD7

Expression Region

1-101

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKPRQREYPTLKSSLNIIRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQKGRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK6 CRISPR/Cas9 KO Plasmid (h)
sc-403345 20 µg

PAK6 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
WDR52 Over-expression Lysate Product
GWB-48EA10 0.1 mg

WDR52 Over-expression Lysate Product

Sign In for Pricing
View Details
POLRMTP1 Human shRNA Plasmid Kit (Locus ID 284167)
TL318251 1 Kit

POLRMTP1 Human shRNA Plasmid Kit (Locus ID 284167)

Sign In for Pricing
View Details
Mouse Glutaredoxin 1 (GLRX) ELISA kit
GTR10441740 96 Well

Mouse Glutaredoxin 1 (GLRX) ELISA kit

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), CF594 conjugate, 0.1mg/mL
BNC941947-500 1x 500 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (rKRT10/1275), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ibuprofen sodium
E6027-1g 1 g

Ibuprofen sodium

Sign In for Pricing
View Details