Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype E Movement protein (V2)

This Recombinant Maize streak virus genotype E Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q91MG4

Expression Region

1-101

Origin

Maize streak virus genotype E (isolate Pat) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAVYSLPRVPTAAPPNAGVPWSHVGEVAVLSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRSPIPNTLEPTAPVHPGPFVPGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFRSF8 Polyclonal Antibody
E-AB-13119-01 20 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-13119-02 60 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-13119-03 120 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF8 Polyclonal Antibody
E-AB-13119-04 200 µL

TNFRSF8 Polyclonal Antibody

Sign In for Pricing
View Details
CDw17 (H018.3G-6.F5), 0.2mg/mL
BNUB1092-500 1x 500 µL

CDw17 (H018.3G-6.F5), 0.2mg/mL

Sign In for Pricing
View Details
Tissue Genomic DNA, Prostate
CD565086 5 µg

Tissue Genomic DNA, Prostate

Sign In for Pricing
View Details