Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype E Movement protein (V2)

This Recombinant Maize streak virus genotype E Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q91MG4

Expression Region

1-101

Origin

Maize streak virus genotype E (isolate Pat) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAVYSLPRVPTAAPPNAGVPWSHVGEVAVLSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRSPIPNTLEPTAPVHPGPFVPGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Decoquinate
TRC-D226880-50MG 50 mg

Decoquinate

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505992 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Human ADH1B activation kit by CRISPRa
GA100085 1 Kit

Human ADH1B activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details