Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype E Movement protein (V2)

This Recombinant Maize streak virus genotype E Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q91MG4

Expression Region

1-101

Origin

Maize streak virus genotype E (isolate Pat) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAVYSLPRVPTAAPPNAGVPWSHVGEVAVLSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRSPIPNTLEPTAPVHPGPFVPGSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TPK1 activation kit by CRISPRa
GA108964 1 Kit

Human TPK1 activation kit by CRISPRa

Sign In for Pricing
View Details
Desmoglein-3 (Squamous Cell Marker) (DSG3/2839), CF488A conjugate, 0.1mg/mL
BNC882839-500 1x 500 µL

Desmoglein-3 (Squamous Cell Marker) (DSG3/2839), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,5-di-tert-butyl 1H,2H,3H,4H,5H,6H-pyrrolo[3,4-c]pyrrole-2,5-dicarboxylate
TRC-D071220-2.5G 2.5 g

2,5-di-tert-butyl 1H,2H,3H,4H,5H,6H-pyrrolo[3,4-c]pyrrole-2,5-dicarboxylate

Sign In for Pricing
View Details
Tide Quencher™ 3 CPG [TQ3 CPG] *1000 Å*
2224-AAT 100 mg

Tide Quencher™ 3 CPG [TQ3 CPG] *1000 Å*

Sign In for Pricing
View Details
FAM190A (CCSER1) (NM_207491) Human Over-expression Lysate
LC404048 20 µg

FAM190A (CCSER1) (NM_207491) Human Over-expression Lysate

Sign In for Pricing
View Details
Piperiacetildenafil
TRC-P481480-25MG 25 mg

Piperiacetildenafil

Sign In for Pricing
View Details