Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype D Movement protein (V2)

This Recombinant Maize streak virus genotype D Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q91MG0

Expression Region

1-101

Origin

Maize streak virus genotype D (isolate Raw) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLVPTAPVHPGPFVPGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCAT Protein Vector (Human) (pPM-C-His)
PV023468 500 ng

LCAT Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Urea Adulteration Test Kit
E-IA-C022 100 Tests

Urea Adulteration Test Kit

Sign In for Pricing
View Details
KTI12 Antibody
E311929 200 µL

KTI12 Antibody

Sign In for Pricing
View Details
Rabbit Anti Human HDAC5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120ul
IRBAHUHDAC5AP573120UL 120 µL

Rabbit Anti Human HDAC5 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence) 120ul

Sign In for Pricing
View Details
XPA (NM_000380) Human Recombinant Protein
PH39612M5 20 µg

XPA (NM_000380) Human Recombinant Protein

Sign In for Pricing
View Details
General Purpose Incubator BIGP-6504
BIGP-6504 1 Unit

General Purpose Incubator BIGP-6504

Sign In for Pricing
View Details