Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype D Movement protein (V2)

This Recombinant Maize streak virus genotype D Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

Q91MG0

Expression Region

1-101

Origin

Maize streak virus genotype D (isolate Raw) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQSAIYTLPRVPTAAPTTGGVSWSHVGEVAILSFVALICIYLLYLWVLRDLILVLKAR RGRSTEELIFGSEAVDRRHPIPNTLVPTAPVHPGPFVPGQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM169B Lentiviral Activation Particles (h2)
sc-415333-LAC-2 200 µL

FAM169B Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
RBM11 Protein Lysate (Mouse) with C-HA Tag
38594034 100 µg

RBM11 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-Synaptotagmin-10/SYT10 Antibody Picoband® Fluoro594 Conjugated
A14108-2-Fluoro594 100 µg/Vial

Anti-Synaptotagmin-10/SYT10 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Human Chondromodulin-1 MAb (Clone 394002)
MAB41681 100 µg

Human Chondromodulin-1 MAb (Clone 394002)

Sign In for Pricing
View Details
Rabbit Polyclonal LSMD1 Antibody
NBP2-84149-0.1mL 0.1 mL

Rabbit Polyclonal LSMD1 Antibody

Sign In for Pricing
View Details
TSPAN2 (Tetraspanin 2, 6330415F13Rik, FLJ12082, TSN2, TSPAN-2) (MaxLight 550)
MBS6219845-01 0.1 mL

TSPAN2 (Tetraspanin 2, 6330415F13Rik, FLJ12082, TSN2, TSPAN-2) (MaxLight 550)

Sign In for Pricing
View Details