Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

This Recombinant Staphylococcus aureus Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD, PGA synthesis protein IcaD, Poly-beta-1,6-GlcNAc synthesis protein IcaD, Biofilm polysaccharide intercellular ad

UniProt

Q9RQP8

Expression Region

1-101

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVKPRQREYPTLKSSLNIVRETALIAISCVFWIYCLVVLLVYIGTIFEIHDESINTIRVA LNIENTEILDIFETMGIFAIIIFVFFTISILIQKWQRGRES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079113-01 0.1 mL

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079113-02 0.2 mL

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079113-03 0.5 mL

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079113-04 1 mL

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079113-05 5 mL

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)
MBS2079113-06 5x 5 mL

APC-Linked Polyclonal Antibody to Toll Like Receptor Adaptor Molecule 1 (TICAM1)

Sign In for Pricing
View Details