Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype A Movement protein (V2)

This Recombinant Maize streak virus genotype A Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

P0C648

Expression Region

1-101

Origin

Maize streak virus genotype A (isolate Kenya) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQNALYYQPRVPTAAPTSGGVPWSRVGEVAILSFVALICFYLLYLWVLRDLILVLKAR QGRSTEELIFGGQAVDRSNPIPNIPAPPSQGNPGPFVPGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(7a,17b)-17-Hydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)sulfinyl]nonyl]androst-4-en-3-one
TRC-H244540-2.5MG 2.5 mg

(7a,17b)-17-Hydroxy-7-[9-[(4,4,5,5,5-pentafluoropentyl)sulfinyl]nonyl]androst-4-en-3-one

Sign In for Pricing
View Details
Concanavalin A Coated - 96 well Solid plates - White PS
MCW07F-CON A/W 10x 96 Well Plates

Concanavalin A Coated - 96 well Solid plates - White PS

Sign In for Pricing
View Details
GRP78 (HSPA5) Rabbit Polyclonal Antibody
AP11333PU-N 200 µL

GRP78 (HSPA5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAGLN3 (NM_001008272) Human Over-expression Lysate
LC423411 20 µg

TAGLN3 (NM_001008272) Human Over-expression Lysate

Sign In for Pricing
View Details
Polystyrene A Sulfonyl Chloride
HA5005600431.25G 25 g

Polystyrene A Sulfonyl Chloride

Sign In for Pricing
View Details
Nuclear Matrix Protein p84 (THOC1) (C-term) Rabbit Polyclonal Antibody
AP54240PU-N 400 µL

Nuclear Matrix Protein p84 (THOC1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details