Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype A Movement protein (V2)

This Recombinant Maize streak virus genotype A Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

P0C648

Expression Region

1-101

Origin

Maize streak virus genotype A (isolate Kenya) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQNALYYQPRVPTAAPTSGGVPWSRVGEVAILSFVALICFYLLYLWVLRDLILVLKAR QGRSTEELIFGGQAVDRSNPIPNIPAPPSQGNPGPFVPGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]
TA805565BM 100 µL

Progesterone Receptor (PGR) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4A11]

Sign In for Pricing
View Details
Finerenone-D5
TRC-F436791-1MG 1 mg

Finerenone-D5

Sign In for Pricing
View Details
Mmp3 Mouse Gene Knockout Kit (CRISPR)
KN310182BN 1 Kit

Mmp3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
EGFR (31G7), CF594 conjugate, 0.1mg/mL
BNC941194-500 1x 500 µL

EGFR (31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bromoperidol Decanoate
TRC-B686130-2.5MG 2.5 mg

Bromoperidol Decanoate

Sign In for Pricing
View Details
RGR (NM_002921) Human Over-expression Lysate
LY419024 100 µg

RGR (NM_002921) Human Over-expression Lysate

Sign In for Pricing
View Details