Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype A Movement protein (V2)

This Recombinant Maize streak virus genotype A Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

P14992

Expression Region

1-101

Origin

Maize streak virus genotype A (isolate South Africa) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQNALYYQPRVPTAAPTSGGVPWSRVGEVAILSFVALICFYLLYLWVLRDLILVLKAR QGRSTEELIFGGQAVDRSNPIPNLPAPPSQGNPGPFVPGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein A I Antibody
R32177 100 µg

Apolipoprotein A I Antibody

Sign In for Pricing
View Details
4-APB Hydrochloride
TRC-A790445-25MG 25 mg

4-APB Hydrochloride

Sign In for Pricing
View Details
CKR-10 CRISPR/Cas9 KO Plasmid (m)
sc-419710 20 µg

CKR-10 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Foxn2 Antibody - N-terminal region : Biotin (ARP37593_P050-Biotin)
ARP37593_P050-Biotin 100 µL

Foxn2 Antibody - N-terminal region : Biotin (ARP37593_P050-Biotin)

Sign In for Pricing
View Details
Recombinant Human CD45/PTPRC (C-6His)
32-11203-50 50 µg

Recombinant Human CD45/PTPRC (C-6His)

Sign In for Pricing
View Details
Lentiviral human TMEM256 sgRNA gene knockout kit - Lentiviral human TMEM256 sgRNA gene knockout kit (100)
GTR15398641 1 Vial

Lentiviral human TMEM256 sgRNA gene knockout kit - Lentiviral human TMEM256 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details