Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Maize streak virus genotype A Movement protein (V2)

This Recombinant Maize streak virus genotype A Movement protein (V2) spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Movement protein, MP

UniProt

P14992

Expression Region

1-101

Origin

Maize streak virus genotype A (isolate South Africa) (MSV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPQNALYYQPRVPTAAPTSGGVPWSRVGEVAILSFVALICFYLLYLWVLRDLILVLKAR QGRSTEELIFGGQAVDRSNPIPNLPAPPSQGNPGPFVPGTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYA4 (NM_004100) Human Tagged ORF Clone
RC211486 10 µg

EYA4 (NM_004100) Human Tagged ORF Clone

Sign In for Pricing
View Details
ARN24139
471111 5.0mg

ARN24139

Sign In for Pricing
View Details
TPH1 Polyclonal Antibody
MBS127155-01 0.02 mL

TPH1 Polyclonal Antibody

Sign In for Pricing
View Details
TPH1 Polyclonal Antibody
MBS127155-02 0.1 mL

TPH1 Polyclonal Antibody

Sign In for Pricing
View Details
TPH1 Polyclonal Antibody
MBS127155-03 5x 0.1 mL

TPH1 Polyclonal Antibody

Sign In for Pricing
View Details
6-Dimethylamino-9- (b-D-ribofuranosyl) purine
ND04708-01 1 g

6-Dimethylamino-9- (b-D-ribofuranosyl) purine

Sign In for Pricing
View Details