Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrobacterium tumefaciens Protein virB2 (virB2)

This Recombinant Agrobacterium tumefaciens Protein virB2 (virB2) spans the amino acid sequence from region 20-121.

Product Specifications

Product Name Alternative

Protein virB2

UniProt

P05351

Expression Region

20-121

Origin

Agrobacterium tumefaciens (strain 15955)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRASLGLVAGVVGGIVIMFGASFLGQTLTGGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF625 AAV Vector (Human) (CMV)
51679101 1 µg

ZNF625 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
CNTN3 Polyclonal Antibody
E914759 100 µL

CNTN3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SLC45A4 Antibody
NBP2-98631-100ul 100 µL

Rabbit Polyclonal SLC45A4 Antibody

Sign In for Pricing
View Details
MLF1IP shRNA (m) Lentiviral Particles
sc-61058-V 200 µL

MLF1IP shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Potassium ferrocyanide trihydrate, ?Hi-A
GRM1048-500G 1 unit

Potassium ferrocyanide trihydrate, ?Hi-A

Sign In for Pricing
View Details
Rabbit Polyclonal Alkaline Phosphatase, Intestinal Antibody
NBP2-33624-25ul 25 µL

Rabbit Polyclonal Alkaline Phosphatase, Intestinal Antibody

Sign In for Pricing
View Details