Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium radiobacter Protein virB2 (virB2)

This Recombinant Rhizobium radiobacter Protein virB2 (virB2) spans the amino acid sequence from region 20-121.

Product Specifications

Product Name Alternative

Protein virB2

UniProt

P09776

Expression Region

20-121

Origin

Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRRSLGLVAGVVGGIVIMFGASFLGQTLTGGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAD1 (NM_005558) Human Recombinant Protein
TP313031 20 µg

LAD1 (NM_005558) Human Recombinant Protein

Sign In for Pricing
View Details
Phosphoric Acid Ammonium Salt (1:1)
TRC-P359150-500G 500 g

Phosphoric Acid Ammonium Salt (1:1)

Sign In for Pricing
View Details
Mouse IgG2a (Fcγ Fragment specific), AlpSdAbs® VHH
HA710252 100 µg

Mouse IgG2a (Fcγ Fragment specific), AlpSdAbs® VHH

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL
BNC881231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SPT5 Antibody
RC-16283-01 50 μL

Recombinant SPT5 Antibody

Sign In for Pricing
View Details
Recombinant SPT5 Antibody
RC-16283-02 100 µL

Recombinant SPT5 Antibody

Sign In for Pricing
View Details