Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhizobium radiobacter Protein virB2 (virB2)

This Recombinant Rhizobium radiobacter Protein virB2 (virB2) spans the amino acid sequence from region 20-121.

Product Specifications

Product Name Alternative

Protein virB2

UniProt

P09776

Expression Region

20-121

Origin

Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMRVISSCAPSLGGAMAWSISSCGPAAAQSAGGGTDPATMVNNICTFILGPFGQSLAVLG IVAIGISWMFGRRSLGLVAGVVGGIVIMFGASFLGQTLTGGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kv2.1/KCNB1 (Ab-567) Antibody
8B1086-AAT 50 µg

Kv2.1/KCNB1 (Ab-567) Antibody

Sign In for Pricing
View Details
CD268 / BAFFR / TNFRSF13C (BAFFR/1557), Biotin conjugate, 0.1mg/mL
BNCB1557-100 1x 100 µL

CD268 / BAFFR / TNFRSF13C (BAFFR/1557), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPP1R14A (Isoform alpha) Rabbit Polyclonal Antibody
AP09505PU-S 50 µL

PPP1R14A (Isoform alpha) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calcitonin Impurity D TFA Salt
TRC-C144559-5MG 5 mg

Calcitonin Impurity D TFA Salt

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) ELISA Kit
RDR-BLVRB-Hu-01 96 Tests

Human Biliverdin Reductase B (BLVRB) ELISA Kit

Sign In for Pricing
View Details
Human Biliverdin Reductase B (BLVRB) ELISA Kit
RDR-BLVRB-Hu-02 48 Tests

Human Biliverdin Reductase B (BLVRB) ELISA Kit

Sign In for Pricing
View Details