Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150)

This Recombinant Arabidopsis thaliana Uncharacterized protein At4g01150, chloroplastic (At4g01150) spans the amino acid sequence from region 63-164.

Product Specifications

Product Name Alternative

Uncharacterized protein At4g01150, chloroplastic

UniProt

O04616

Expression Region

63-164

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ASSEETSSIDTNELITDLKEKWDGLENKSTVLIYGGGAIVAVWLSSIVVGAINSVPLLPK VMELVGLGYTGWFVYRYLLFKSSRKELAEDIESLKKKIAGSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF568 conjugate, 0.1mg/mL
BNC682307-500 1x 500 µL

Moesin (rMSN/492), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF740 conjugate, 0.1mg/mL
BNC741893-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF488A conjugate, 0.1mg/mL
BNC881492-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF568 conjugate, 0.1mg/mL
BNC681884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details