Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Signal peptidase complex subunit 1 (SPCS1)

This Recombinant Bovine Signal peptidase complex subunit 1 (SPCS1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

Q3T134

Expression Region

1-102

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYLAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSSTEDKKPGERKVKRHAKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tial1 Mouse Gene Knockout Kit (CRISPR)
KN517554 1 Kit

Tial1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2463), CF647 conjugate, 0.1mg/mL
BNC472463-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2463), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BNIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E10]
TA802192BM 100 µL

BNIP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3E10]

Sign In for Pricing
View Details
DCP2 Human Gene Knockout Kit (CRISPR)
KN421165 1 Kit

DCP2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Lambda Light Chain (LAM03), CF640R conjugate, 0.1mg/mL
BNC400636-100 1x 100 µL

Human Lambda Light Chain (LAM03), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TMEM178B Human Gene Knockout Kit (CRISPR)
KN431139 1 Kit

TMEM178B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details