Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Signal peptidase complex subunit 1 (SPCS1)

This Recombinant Bovine Signal peptidase complex subunit 1 (SPCS1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Signal peptidase complex subunit 1, EC= 3.4.-.-, Microsomal signal peptidase 12 kDa subunit, SPase 12 kDa subunit

UniProt

Q3T134

Expression Region

1-102

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYLAEQFGWTVYIVMAGFAFSC LLTLPPWPIYRRHPLKWLPVQDSSTEDKKPGERKVKRHAKNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSMAF (NM_003580) Human Recombinant Protein
TP307925M 100 µg

NSMAF (NM_003580) Human Recombinant Protein

Sign In for Pricing
View Details
Cyclophilin 40 (PPID) (N-term) Rabbit Polyclonal Antibody
AP18156PU-N 400 µL

Cyclophilin 40 (PPID) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mepiquat-d16 Chloride
TRC-M225091-5MG 5 mg

Mepiquat-d16 Chloride

Sign In for Pricing
View Details
4-[2-(5-Ethyl-2-pyridinyl)-d4-ethoxy]benzaldehyde
TRC-E925582-25MG 25 mg

4-[2-(5-Ethyl-2-pyridinyl)-d4-ethoxy]benzaldehyde

Sign In for Pricing
View Details
Ezrin Recombinant Rabbit Monoclonal Antibody [JM10-65]
ET1703-25 100 µL

Ezrin Recombinant Rabbit Monoclonal Antibody [JM10-65]

Sign In for Pricing
View Details
PMP2 (NM_002677) Human Recombinant Protein
TP306053 20 µg

PMP2 (NM_002677) Human Recombinant Protein

Sign In for Pricing
View Details