Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma genitalium Uncharacterized protein MG220 (MG220)

This Recombinant Mycoplasma genitalium Uncharacterized protein MG220 (MG220) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Uncharacterized protein MG220

UniProt

Q49403

Expression Region

1-102

Origin

Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLIDKRSYMYKLEKAQAKQVVGGLSFWTFSAGLIMIVNALTGVAHAVNDIFQSTTANAN GSDDDNENKNNSYRSKSNYFNTARFKLGLTPGSSSYSFPVFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-100 1x 100 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/2122), CF488A conjugate, 0.1mg/mL
BNC882122-100 1x 100 µL

Ubiquitin (Autophagy Marker) (UBB/2122), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF594 conjugate, 0.1mg/mL
BNC941527-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1527), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF488A conjugate, 0.1mg/mL
BNC881600-100 1x 100 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details