Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PAPPAS (PAPPA-AS1)

This Recombinant Human Protein PAPPAS (PAPPA-AS1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Protein PAPPAS, DIPLA1 antisense RNA 1, DIPLA1 antisense gene protein 1, DIPLA1-antisense expressed, PAPPAS antisense RNA 1, PAPPAS antisense gene protein 1, PAPPAS-antisense expressed

UniProt

Q5QFB9

Expression Region

1-102

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLS VIGQRWPIDVFSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Silybin A+B mixture - D3
TRC-S465854-1MG 1 mg

Silybin A+B mixture - D3

Sign In for Pricing
View Details
Dystrophia myotonica protein kinase (DMPK) Human qPCR Primer Pair (NM_004409)
HP234717 200 Reactions

Dystrophia myotonica protein kinase (DMPK) Human qPCR Primer Pair (NM_004409)

Sign In for Pricing
View Details
Serine racemase (SRR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D10]
TA500941AM 100 µL

Serine racemase (SRR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D10]

Sign In for Pricing
View Details
TMEM163 Human Gene Knockout Kit (CRISPR)
KN205533 1 Kit

TMEM163 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Arginine tert-Butyl Ester Diacetate Salt
TRC-A769425-2.5G 2.5 g

L-Arginine tert-Butyl Ester Diacetate Salt

Sign In for Pricing
View Details
4-Chloro-2-fluorophenylacetic Acid (~85%)
TRC-C585708-500MG 500 mg

4-Chloro-2-fluorophenylacetic Acid (~85%)

Sign In for Pricing
View Details