Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PAPPAS (PAPPA-AS1)

This Recombinant Human Protein PAPPAS (PAPPA-AS1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

Protein PAPPAS, DIPLA1 antisense RNA 1, DIPLA1 antisense gene protein 1, DIPLA1-antisense expressed, PAPPAS antisense RNA 1, PAPPAS antisense gene protein 1, PAPPAS-antisense expressed

UniProt

Q5QFB9

Expression Region

1-102

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYGFVRKKHRGLFLTTVAALPIWNPISEFVKWYKSHKLSQHCIRICGHLCQKHLDMFLS VIGQRWPIDVFSSVFDHQVSAIGSDIIWWFLKLFLVSFFFFF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (FN1) Human qPCR Primer Pair (NM_212482)
HP234005 200 Reactions

Fibronectin (FN1) Human qPCR Primer Pair (NM_212482)

Sign In for Pricing
View Details
Wide Bore Pipette Tip
P5740 960 Units/Pack

Wide Bore Pipette Tip

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561660 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Tilmicosin-d3
TRC-T440502-5MG 5 mg

Tilmicosin-d3

Sign In for Pricing
View Details
HNF-4-alpha Recombinant Rabbit Monoclonal Antibody [JE63-17]
HA721006 100 µL

HNF-4-alpha Recombinant Rabbit Monoclonal Antibody [JE63-17]

Sign In for Pricing
View Details
N-Palmitoyl-O-phosphocholine Serine-D9
TRC-P347921-1MG 1 mg

N-Palmitoyl-O-phosphocholine Serine-D9

Sign In for Pricing
View Details