Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant NADH-quinone oxidoreductase subunit K 1 (nuoK1)

This Recombinant NADH-quinone oxidoreductase subunit K 1 (nuoK1) spans the amino acid sequence from region 1-102.

Product Specifications

Product Name Alternative

NADH-quinone oxidoreductase subunit K 1, EC= 1.6.99.5, NADH dehydrogenase I subunit K 1, NDH-1 subunit K 1

UniProt

Q67P12

Expression Region

1-102

Origin

Symbiobacterium thermophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAFSLNAYVALSAVLFALGGIGVLVRRSPLAILMCIELMLNAANLLFVAFGRAHGGYEG QIMAFLVITVAAAEVAIGLALTVLLFRRRAEVDVDRVNELKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL
BNC680149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-100 1x 100 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-100 1x 100 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL
BNC742853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF568 conjugate, 0.1mg/mL
BNC680969-100 1x 100 µL

Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details